PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03030.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 362aa    MW: 40717.4 Da    PI: 6.2224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03030.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++l+d+++++G g+W++ ++   ++R++k+c++rw +yl
  Rsa1.0_03030.1_g00002.1 14 KGPWTHEEDQKLIDYIHKHGHGSWRALPKLADLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding51.72e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++++eE++ +++++  lG++ W++Ia ++  gRt++++k++w+++l
  Rsa1.0_03030.1_g00002.1  67 RGKFSAEEEKTILHLHSILGNK-WSAIATHLK-GRTDNEIKNFWNTHL 112
                              89********************.********9.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.105961IPR017930Myb domain
SuperFamilySSF466893.1E-3011108IPR009057Homeodomain-like
SMARTSM007171.4E-141363IPR001005SANT/Myb domain
PfamPF002495.6E-171461IPR001005SANT/Myb domain
CDDcd001672.70E-111661No hitNo description
PROSITE profilePS5129425.962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2665117IPR009057Homeodomain-like
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002492.1E-1567112IPR001005SANT/Myb domain
CDDcd001676.91E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTHE EDQKLIDYIH KHGHGSWRAL PKLADLNRCG KSCRLRWTNY  60
LRPDIKRGKF SAEEEKTILH LHSILGNKWS AIATHLKGRT DNEIKNFWNT HLKKKLIQMG  120
IDPVTHQPRT DLFASLPQLI ALANLKDLIE QTSQFSSIQA EAAQLAKLQY LNGMLNSSAS  180
LSNNNNNNPS SILDIDHNHA MNLLNSMVSW NKENNSNFNP ALEHEADHQN QGLFPLGFFI  240
DSTTQPLQQQ QYHLNNSPSE KPSQGDPLLD HVPFNLQTPL NSEDHFIENL VKHPIDQDHD  300
DPSSWILPSL IDNSPKNAMS SLPYNKLADA DASSSSSYGG GDGASLYWPD FCFDESLIND  360
IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195600.0AY519560.1 Arabidopsis thaliana MYB transcription factor (At1g34670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589811.10.0PREDICTED: myb-related protein 330
TrEMBLA0A078EMC40.0A0A078EMC4_BRANA; BnaC06g08330D protein
TrEMBLA0A0D3CRR80.0A0A0D3CRR8_BRAOL; Uncharacterized protein
STRINGAT1G34670.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.10.0myb domain protein 93